Recombinant Human ABCC4 Protein, GST-Tagged

• Cat.No.: ABCC4-048H
• Product Overview: Human ABCC4 partial ORF ( AAH41560, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]
• Molecular Mass: 37.73 kDa
• AA Sequence: MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABCC4 ATP-binding cassette, sub-family C (CFTR/MRP), member 4 [ Homo sapiens ]
• Official Symbol: ABCC4
• Synonyms: ABCC4; ATP-binding cassette, sub-family C (CFTR/MRP), member 4; multidrug resistance-associated protein 4; bA464I2.1 (ATP binding cassette; sub family C (CFTR/MRP); member 4); canalicular multispecific organic anion transporter (ABC superfamily); EST170205; MOAT B; MOATB; MRP4; multidrug resistance associated protein 4; multispecific organic anion transporter B; MRP/cMOAT-related ABC transporter; ATP-binding cassette sub-family C member 4; multi-specific organic anion transporter B; bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4); MOAT-B
• Gene ID: 10257
• mRNA Refseq: NM_001105515
• Protein Refseq: NP_001098985
• MIM: 605250
• UniProt ID: O15439