Recombinant Human ABCB10 Protein, GST-Tagged

• Cat.No.: ABCB10-038H
• Product Overview: Human ABCB10 partial ORF ( NP_036221, 233 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008]
• Molecular Mass: 34.43 kDa
• AA Sequence: VYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABCB10 ATP-binding cassette, sub-family B (MDR/TAP), member 10 [ Homo sapiens ]
• Official Symbol: ABCB10
• Synonyms: ABCB10; ATP-binding cassette, sub-family B (MDR/TAP), member 10; ATP-binding cassette sub-family B member 10, mitochondrial; ABC transporter 10 protein; ATP binding cassette sub family B member 10; mitochondrial; ATP binding cassette transporter 10; EST20237; M ABC2; mitochondrial ATP binding cassette 2; MTABC2; ATP-binding cassette transporter 10; mitochondrial ATP-binding cassette 2; M-ABC2
• Gene ID: 23456
• mRNA Refseq: NM_012089
• Protein Refseq: NP_036221
• MIM: 605454
• UniProt ID: Q9NRK6