Recombinant Human A2M Protein, GST-tagged

• Cat.No.: A2M-003H
• Product Overview: Human A2M partial ORF ( NP_000005.2, 641 a.a. - 730 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified. [provided by RefSeq, Nov 2016]
• Molecular Mass: 35.64 kDa
• AA Sequence: DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: A2M alpha-2-macroglobulin [ Homo sapiens ]
• Official Symbol: A2M
• Synonyms: A2M; alpha-2-macroglobulin; CPAMD5; FWP007; S863 7; alpha-2-M; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; A2MD; S863-7; DKFZp779B086
• Gene ID: 2
• mRNA Refseq: NM_000014
• Protein Refseq: NP_000005
• MIM: 103950
• UniProt ID: P01023