Recombinant HTLV-2 gp46 protein, His-tagged

Cat.No. : GB46-02VH
Product Overview : Recombinant HTLV-2 gp46 protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HTLV2
Source : HEK293
Tag : His
Form : PBS, pH7.4
Molecular Mass : The protein has a calculated MW of 33.3 kDa.
AA Sequence : QQSRCTLTIGISSYHSSPCSPTQPVCTWNLDLNSLTTDQRLHPPCPNLITYSGFHKTYSLYLFPHWIKKPNRQGLGYYSPSYNDPCSLQCPYLGCQAWTSAYTGPVSSPSWKFHSDVNFTQEVSQVSLRLHFSKCGSSMTLLVDAPGYDPLWFITSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKFIQLTLQSTNYSCMVCVDRSSLSSWHVLYTPNISIPQQTSSRTILFPSLALPAPPSQPFPWTHCYQPRLQAITTDNCNNSIILPPFSLAPVPPPATRRRRHHHHHH
Purity : >50%,by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.21 mg/ml

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GB46 Products

Required fields are marked with *

My Review for All GB46 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon