Recombinant HTLV-1 gp46 protein, His-tagged
Cat.No. : | GB46-01VH |
Product Overview : | Recombinant HTLV-1 gp46 protein, fused to His-tag, was expressed in HEK293. |
Availability | February 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HTLV1 |
Source : | HEK293 |
Tag : | His |
Form : | PBS, pH7.4 |
Molecular Mass : | The protein has a calculated MW of 32.2 kDa. |
AA Sequence : | SCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSHHHHHH |
Purity : | >90%,by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.63 mg/ml |
◆ Recombinant Proteins | ||
CTNNA3-2307HF | Recombinant Full Length Human CTNNA3 Protein, GST-tagged | +Inquiry |
PCSK9-312H | Recombinant Human PCSK9 protein(Met1-Gln692), His-tagged | +Inquiry |
CXCR4-1175H | Recombinant Human CXCR4 Protein, His-SUMO/MYC-tagged | +Inquiry |
CCL1-111C | Active Recombinant Human CCL1 Protein (74 aa) | +Inquiry |
QDPR-1703C | Recombinant Chicken QDPR | +Inquiry |
◆ Native Proteins | ||
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LZTS3-1418HCL | Recombinant Human LZTS3 cell lysate | +Inquiry |
DLL4-2507HCL | Recombinant Human DLL4 cell lysate | +Inquiry |
H2BFWT-315HCL | Recombinant Human H2BFWT lysate | +Inquiry |
BCAR1-8498HCL | Recombinant Human BCAR1 293 Cell Lysate | +Inquiry |
COLEC12-403RCL | Recombinant Rat COLEC12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GB46 Products
Required fields are marked with *
My Review for All GB46 Products
Required fields are marked with *
0
Inquiry Basket