Recombinant HTLV-1 gp46 protein, His-tagged
Cat.No. : | GB46-01VH |
Product Overview : | Recombinant HTLV-1 gp46 protein, fused to His-tag, was expressed in HEK293. |
Availability | April 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HTLV1 |
Source : | HEK293 |
Tag : | His |
Form : | PBS, pH7.4 |
Molecular Mass : | The protein has a calculated MW of 32.2 kDa. |
AA Sequence : | SCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSHHHHHH |
Purity : | >90%,by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.63 mg/ml |
◆ Recombinant Proteins | ||
GB46-01VH | Recombinant HTLV-1 gp46 protein, His-tagged | +Inquiry |
GB46-02VH | Recombinant HTLV-2 gp46 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GB46 Products
Required fields are marked with *
My Review for All GB46 Products
Required fields are marked with *
0
Inquiry Basket