Recombinant Horse PRL protein, hFc-tagged

• Cat.No.: PRL-4497H
• Product Overview: Recombinant Horse PRL protein(P12420)(31-229aa), fused to C-terminal hFc tag, was expressed in Mammalian cell.

Specification

• Species: Horse
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 31-229aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.9 kDa
• AA Sequence: LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PRL prolactin [ Equus caballus ]
• Official Symbol: PRL
• Synonyms: PRL; prolactin; preprolactin
• Gene ID: 100034034
• mRNA Refseq: NM_001081896
• Protein Refseq: NP_001075365