Recombinant Human PRL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRL-6262H
• Product Overview: PRL MS Standard C13 and N15-labeled recombinant protein (NP_000939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.
• Molecular Mass: 25.9 kDa
• AA Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRL prolactin [ Homo sapiens (human) ]
• Official Symbol: PRL
• Synonyms: PRL; prolactin; GHA1; prolactin; decidual prolactin; growth hormone A1
• Gene ID: 5617
• mRNA Refseq: NM_000948
• Protein Refseq: NP_000939
• MIM: 176760
• UniProt ID: P01236