Recombinant HBV-D X protein, His-SUMO-tagged
Cat.No. : | X-4341H |
Product Overview : | Recombinant HBV-D X protein(O93195)(1-154aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HBV-D |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 1-154aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.7 kDa |
AA Sequence : | MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
N4BP2L1-10373M | Recombinant Mouse N4BP2L1 Protein | +Inquiry |
FCGR3A-052H | Recombinant Human FCGR3A protein, His-Avi-tagged, Biotinylated | +Inquiry |
NEK9-2902H | Recombinant Human NEK9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LEO1-1288H | Recombinant Human LEO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLCO1C1-15543M | Recombinant Mouse SLCO1C1 Protein | +Inquiry |
◆ Native Proteins | ||
SERPINA3-27285TH | Native Human SERPINA3 | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
CFH-115H | Active Native Human Factor H | +Inquiry |
MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETFA-6532HCL | Recombinant Human ETFA 293 Cell Lysate | +Inquiry |
KLHDC8A-4917HCL | Recombinant Human KLHDC8A 293 Cell Lysate | +Inquiry |
RHOV-543HCL | Recombinant Human RHOV lysate | +Inquiry |
NRIP3-3694HCL | Recombinant Human NRIP3 293 Cell Lysate | +Inquiry |
CYGB-7134HCL | Recombinant Human CYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All X Products
Required fields are marked with *
My Review for All X Products
Required fields are marked with *
0
Inquiry Basket