Recombinant HA-His Protein, His-tagged

• Cat.No.: HA-His-243
• Product Overview: Recombinant HA-His Protein with His tag was expressed in E. coli.

Specification

• Source: E.coli
• Tag: His
• Molecular Mass: ~ 37 kDa
• AA Sequence: MGMTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGSYPYDVPDYAGSHHHHHH
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Official Symbol: HA-His
• Synonyms: HA-His