Recombinant Gossypium mexicanum LOC107910168 protein(1-313aa(H295N)), His-SUMO&His-tagged

• Cat.No.: LOC107910168-3225G
• Product Overview: Recombinant Gossypium mexicanum LOC107910168 protein(A0A1U8JT65)(1-313aa(H295N)), fused with N-terminal His and SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Gossypium mexicanum
• Source: E.coli
• Tag: N-His-SUMO&C-His
• ProteinLength: 1-313aa(H295N)
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.1 kDa
• AASequence: MTSDGATSTPAPRRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEDDGTTYRKGCKPPPIDIGGSSSKITPFSSQNPSPLSSAFPSPIPSCQVSPSSSSYPSPTRFDANNPSTLLPFLRNAIPSSLPPLRISNSAPVTPPLSSPTSRNPKPLPNWETIAKESMASFNYPFYAVSAPASPTHRHFHAPATIPECDESDTSTVESGQWISFQKFAPSTSQVPTSPTFFKLVKHLPPQNLHNDLGVKDKGRGAEFEFESGHLKPWEGERINDIGMDDLELTLGSGKPQC
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.