Recombinant Full Length Human Bri3-Binding Protein(Bri3Bp) Protein, His-Tagged
Cat.No. : | RFL23313HF |
Product Overview : | Recombinant Full Length Human BRI3-binding protein(BRI3BP) Protein (Q8WY22) (1-251aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-251) |
Form : | Lyophilized powder |
AA Sequence : | MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSL FGEDNVRAAQKFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSS SPARALLLVGVVLLAYWFLSLTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGE PENAVLPLCFVVAVYFMTGPMGFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNR VLESLDRSKDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BRI3BP |
Synonyms | BRI3BP; KG19; BRI3-binding protein; I3-binding protein; Cervical cancer 1 proto-oncogene-binding protein KG19; HCCRBP-1 |
UniProt ID | Q8WY22 |
◆ Recombinant Proteins | ||
RFL18446MF | Recombinant Full Length Mouse Bri3-Binding Protein(Bri3Bp) Protein, His-Tagged | +Inquiry |
BRI3BP-3409C | Recombinant Chicken BRI3BP | +Inquiry |
BRI3BP-340H | Recombinant Human BRI3BP Protein, GST-tagged | +Inquiry |
BRI3BP-2493M | Recombinant Mouse BRI3BP Protein | +Inquiry |
RFL23313HF | Recombinant Full Length Human Bri3-Binding Protein(Bri3Bp) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRI3BP Products
Required fields are marked with *
My Review for All BRI3BP Products
Required fields are marked with *
0
Inquiry Basket