Recombinant Full Length Zea Mays Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL34172ZF |
Product Overview : | Recombinant Full Length Zea mays Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P05641) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P05641 |
◆ Recombinant Proteins | ||
HIP1R-3232H | Recombinant Human HIP1R Protein (Ser771-Ala1012), N-His tagged | +Inquiry |
SAOUHSC-01809-3835S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01809 protein, His-tagged | +Inquiry |
HLA-G&B2M-6745H | Recombinant Human HLA-G&B2M&Peptide (RIIPRHLQL) Tetramer protein, His-Avi-tagged, Biotinylated | +Inquiry |
STIP1-5448R | Recombinant Rat STIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SIAH1-4629H | Recombinant Human SIAH1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H1C-5553HCL | Recombinant Human HIST1H1C 293 Cell Lysate | +Inquiry |
PEX1-1335HCL | Recombinant Human PEX1 cell lysate | +Inquiry |
AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
KIAA1199-915HCL | Recombinant Human KIAA1199 cell lysate | +Inquiry |
WDSUB1-1929HCL | Recombinant Human WDSUB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket