Recombinant Full Length Nostoc Sp. Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL18652NF |
Product Overview : | Recombinant Full Length Nostoc sp. Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P20093) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAIYDPSDPVLNPMWRQGM FVLPFMARLGVTQSWGGWSVTGGTATDPGFWSFEGVAAAHIVLSGLLFLAAVWHWVYWDL ELFRDPRTGEPALDLPKMFGIHLFLSGLLCFGFGAFHLTGLFGPGMWISDPYGVTGSVQP VAPEWGPDGFNPFNPGGVVAHHIAAGIVGIIAGLFHLTVRPPERLYKALRMGNIETVLSS SIAAVFFAAFVVAGTMWYGNATTPIELFGPTRYQWDQGYFHQEIERRVQSSVAQGASLSE AWSQIPEKLAFYDYVGNSPAKGGLFRTGPMVKGDGIAQSWQGHGVFKDAEGRELTVRRLP NFFETFPVILTDADGVVRADIPFRRAESKYSFEQSGVTVSFYGGDLDGKTFTDPADVKKY ARKAQGGEIFEFDRETLNSDGVFRTSPRGWFTFGHAVFALLFFFGHLWHGARTIYRDVFA GVEADLEEQVEWGLFQKVGDKSTRVRKEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; all0138; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P20093 |
◆ Native Proteins | ||
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
CAT-21H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUS4L-6787HCL | Recombinant Human DUS4L 293 Cell Lysate | +Inquiry |
GSTT2-5708HCL | Recombinant Human GSTT2 293 Cell Lysate | +Inquiry |
Brain-794G | Guinea Pig Brain Membrane Lysate, Total Protein | +Inquiry |
CERCAM-332HCL | Recombinant Human CERCAM cell lysate | +Inquiry |
HeLa-026HCL | Human Nocodazole Stimulated HeLa Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket