Recombinant Full Length Ashbya Gossypii Palmitoyltransferase Pfa3(Pfa3) Protein, His-Tagged
Cat.No. : | RFL20928AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Palmitoyltransferase PFA3(PFA3) Protein (Q75AW7) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MHICSLIPILFPKLLTCGLALYSAVVLWLKVSVIGSFIQGTVLLTLVPLILYAYFSTIAV GPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVKCKVWKPDRCHHC SACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITTWDLVVWFRAHSY ERELLNVHLVCLWALSAAATVALTAFCAFNIYLVCKNETTGEYQRRSTLNSDLEMYADCT NGPRTVIENPFDLGSRRRNWAAVMGDTWKEWLLPIRTTASQKARHSFDESGLYFKIDEQA HAKLAESMALQARLITRFNSKRAVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA3 |
Synonyms | PFA3; ADL197C; Palmitoyltransferase PFA3; Protein fatty acyltransferase 3 |
UniProt ID | Q75AW7 |
◆ Native Proteins | ||
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
Lectin-1725W | Native Wheat Germ Lectin | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAG6-8510HCL | Recombinant Human BAT3 293 Cell Lysate | +Inquiry |
TXNIP-620HCL | Recombinant Human TXNIP 293 Cell Lysate | +Inquiry |
SNX24-1592HCL | Recombinant Human SNX24 293 Cell Lysate | +Inquiry |
LRRN1-4619HCL | Recombinant Human LRRN1 293 Cell Lysate | +Inquiry |
PRELP-002HCL | Recombinant Human PRELP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PFA3 Products
Required fields are marked with *
My Review for All PFA3 Products
Required fields are marked with *
0
Inquiry Basket