Recombinant Full Length Yarrowia Lipolytica Gpi Mannosyltransferase 4(Smp3) Protein, His-Tagged
Cat.No. : | RFL17948YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica GPI mannosyltransferase 4(SMP3) Protein (Q6CDD0) (1-510aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-510) |
Form : | Lyophilized powder |
AA Sequence : | MIWNNRLILALSLLLRLHLAISPSYIHPDEHFQGPEYALGNLFDWAHETTWEFRGDSPIR SFVPLWILYTAPLSVLNFLWKGQLSPREAYWFIRAGHALAYWILGDMALDRLSDSKKSKT KTLYLVGCSYVTWSYQSHTFSNSTETLLVLWCLVIIKESQQRHSMHHQRVHKFMDAGLLG LLIVIGTWNRVTFPLWLIVPGLTYLRKYLIHNISSLILLIASVALTAFFVIHVDSVHYDL EWTITPLNSFLYNSQGHNLAEHGIHNRLTHLVSNLPVLLGPLLILLRTPSQYWKSLQFQS AISGVFFLSLFPHQEARFLMPAVPLLISCYDINAVPRRFTSAIFLLSYVFNIIMGFLMGT LHQGGVVPAQHYLSKHVDSGSHTVVYWRTYKPPSWLLGIPEGELEILDKDHPLGTNLFKR VTDEIENIQIRHKKTMVTVLDLMGSSPEYVNDVIAALAPINPLLVAPVAGLKELDLPAYK EVWKTRFHLGLDHIDGLESLEPGLVVLEVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMP3 |
Synonyms | SMP3; YALI0C01485g; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV |
UniProt ID | Q6CDD0 |
◆ Recombinant Proteins | ||
FDXR-1968R | Recombinant Rat FDXR Protein, His (Fc)-Avi-tagged | +Inquiry |
PDCD1-189HA | Recombinant Human PDCD1 protein, Fc-tagged, APC labeled | +Inquiry |
CRYBG2-5446H | Recombinant Human CRYBG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL33501BF | Recombinant Full Length Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
ALOX15-3674H | Recombinant Human ALOX15 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMM10-1073HCL | Recombinant Human TIMM10 293 Cell Lysate | +Inquiry |
CST5-3027HCL | Recombinant Human CST5 cell lysate | +Inquiry |
DOC2B-502HCL | Recombinant Human DOC2B cell lysate | +Inquiry |
C2CD2L-1791HCL | Recombinant Human C2CD2L cell lysate | +Inquiry |
ICOS-1724MCL | Recombinant Mouse ICOS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMP3 Products
Required fields are marked with *
My Review for All SMP3 Products
Required fields are marked with *
0
Inquiry Basket