Recombinant Full Length Xenopus Tropicalis Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged
Cat.No. : | RFL27615XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Zinc transporter ZIP14(slc39a14) Protein (A4IGY6) (17-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (17-462) |
Form : | Lyophilized powder |
AA Sequence : | GPTPSTGKELSAASFLQDILQRYGENESLSMPQLQSLLENLEVGKGGGNQRNMSQCLSSS TLFAAHNLTSGSVVDAEGFQSFCPTILQQLETRACQESPAFQNETTPGAEGRPSPGEVWG YGFLCVTVISLCSLFGAGVVPFMKKACYKRLLLFCIALAIGTLFSNALFQLIPEAFGFNP LEDSYVFTSSVIFGGFYLFFFTEKVLKMMLKQKHEHGHSHYSADTSKRDAEEGVTEKLQN GDLDHMIPPPHGSESDLRGDEKAVQQQDLPGQQSSCYWLKGIRYSDIGTLAWMITLSDGL HNFIDGLAIGASFTVSVFQGVSTSIAILCEEFPHELGDFVILLNAGMSIPQALFFNFLSA CCCYLGLAFGILAGSHFSSNWIFALAGGMFLYIALSDMFPEMNEVSKEDEEGGRAFSAFM IQNAGLLTGFAIMLLLTTFSGQIQLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc39a14 |
Synonyms | slc39a14; Metal cation symporter ZIP14; Solute carrier family 39 member 14; Zrt- and Irt-like protein 14; ZIP-14 |
UniProt ID | A4IGY6 |
◆ Recombinant Proteins | ||
SLC39A14-15434M | Recombinant Mouse SLC39A14 Protein | +Inquiry |
RFL2265HF | Recombinant Full Length Human Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
SLC39A14-6827HF | Recombinant Full Length Human SLC39A14 Protein | +Inquiry |
RFL18086BF | Recombinant Full Length Bovine Zinc Transporter Zip14(Slc39A14) Protein, His-Tagged | +Inquiry |
SLC39A14-681H | Recombinant Human SLC39A14 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc39a14 Products
Required fields are marked with *
My Review for All slc39a14 Products
Required fields are marked with *
0
Inquiry Basket