Recombinant Human SLC39A14 protein, His-tagged

• Cat.No.: SLC39A14-4564H
• Product Overview: Recombinant Human SLC39A14 protein(Q15043)(31-157aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 31-157a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.8 kDa
• AASequence: SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SLC39A14 solute carrier family 39 (zinc transporter), member 14 [ Homo sapiens ]
• Official Symbol: SLC39A14
• Synonyms: SLC39A14; solute carrier family 39 (zinc transporter), member 14; solute carrier family 39 (metal ion transporter), member 14; zinc transporter ZIP14; KIAA0062; NET34; ZIP14; ZIP-14; Zrt-, Irt-like protein 14; zrt- and Irt-like protein 14; solute carrier family 39 member 14; LIV-1 subfamily of ZIP zinc transporter 4; cig19; LZT-Hs4
• Gene ID: 23516
• mRNA Refseq: NM_001128431
• Protein Refseq: NP_001121903
• MIM: 608736
• UniProt ID: Q15043