Recombinant Full Length Xenopus Tropicalis Transmembrane Protein 87A(Tmem87A) Protein, His-Tagged
Cat.No. : | RFL18102XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Transmembrane protein 87A(tmem87a) Protein (Q28EW0) (27-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-541) |
Form : | Lyophilized powder |
AA Sequence : | VPEPGIWTVPIGSGAGSLFFRKTLYNSTNIKVKLISPNCPTPVKLTVKWYLRSHRCYNQF TNLEEVLERHHTNLDTTDNFCKNVSKPDFCDKNEDKNIDCNKDMHALPTLKMSKLVPKIS VNQSAGSKNPLNQMDFDIVARTYQDGPYLFVLQVKGDENVKWNLSVTVSMKGPHGFISAS DWPLMIFYMVMCIMYILLALLWFIWSACYWKDLLRIQFWIAAVIFLGMLEKAVYYAEYQN TDNTGVSSHGLLIFAELISSIKRTLARLLVTIVSLGYGIIKPRLGAVMHRVVGMGVLYFV FAAVEGVMRIIGAKEYDLVLLAGIPLALLDSGLCWWIFVSLAQTMKTLKLRKNTVKYSLY RHFTNTLIFAILASIIFMIWRTKKFQLVDCQADWMELWVDDAYWRFLFFIILLVIMFLWR PSANNQRYAFTPLIDDSDDEVEEFLVTDHLAEGMKLRGTKPECNGAPKPPATNIDEDLKW VEENIPSSFADAALPVLMDSDEEIMMTKYEMSKIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem87a |
Synonyms | tmem87a; TGas047b06.1; Transmembrane protein 87A |
UniProt ID | Q28EW0 |
◆ Recombinant Proteins | ||
TTC8-4832R | Recombinant Rhesus Macaque TTC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL23-238H | Recombinant Human CCL23 protein(Arg46-Asn120), His-tagged | +Inquiry |
ZNF580-3273H | Recombinant Human ZNF580 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYLD-11760H | Recombinant Human CYLD, GST-tagged | +Inquiry |
MRPL22-990H | Recombinant Human MRPL22, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgE-01M | Native Mouse IgE protein | +Inquiry |
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS26-4140HCL | Recombinant Human MRPS26 293 Cell Lysate | +Inquiry |
EPHA4-1933HCL | Recombinant Human EPHA4 cell lysate | +Inquiry |
AMBRA1-8887HCL | Recombinant Human AMBRA1 293 Cell Lysate | +Inquiry |
Colon-91C | Cynomolgus monkey Colon Membrane Lysate | +Inquiry |
SAMD4A-1558HCL | Recombinant Human SAMD4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem87a Products
Required fields are marked with *
My Review for All tmem87a Products
Required fields are marked with *
0
Inquiry Basket