Recombinant Full Length Xenopus Laevis Upf0668 Protein C10Orf76 Homolog Protein, His-Tagged
Cat.No. : | RFL26531XF |
Product Overview : | Recombinant Full Length Xenopus laevis UPF0668 protein C10orf76 homolog Protein (Q6DCT2) (1-689aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-689) |
Form : | Lyophilized powder |
AA Sequence : | MAQIEKKVGLLRKSSASKKPLKEKVVLMYDEIFTKEDPTKSNPRFWDELFLMKVNIEYLE SKLESLDGEELMKLKDNINSLFQHCIHALRAEHQIRVVNSLQTLCALIRGVHQKNKPTSG FDIINMLMGFDKAELRMKNLMESLDLLLCGDGSESLKSLCLKLLLCLVTVTDNISQNTIL EYVMINSIFEAILQILSNPLSRRQHGYDAVVLLALLVNYRKYESVNPYIVKLSIVDDENT LNGMGLVIARALFEYNRQYTDKEEENQTGFFSALTNMVGSMFIADADEKISVQTNEAILL ALYEAVHLNRNFITVLAQSHPEMGLVAVPISPIPTTPTSPLGTTPPSSDVISPTELPMDA DVQTSNLLITFLKYSSIVMQDTKDEHRLNSGKLCLIILTCIAEDQYANAFLHDDNMNFRV NLHRMPMRHRKKAADKNIPCRPLVCAVLDLMVEFIVTHMMKDFPMDLYTRCIQIVHKVLC YQKKCRVRLHYTWRELWLALINLLKFLMSNETVLLAKHNIFTLTLMVVNLFNMFITYGDT FLPTPSSYDELYYEIIRMHQIFDNLYSMVLRLSTNAGQWKEPASKVTHSLVNIRAIINHF NPKIESYAAVNHISQLSEEQVLEVVRSNYDTLTLKLQDGLDQYERYSEQHKEAAFFKELA RSISINVRKNVAFNTLSQEILLKEFSTIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Xenopus laevis UPF0668 protein C10orf76 homolog |
Synonyms | armh3; Armadillo-like helical domain-containing protein 3 |
UniProt ID | Q6DCT2 |
◆ Recombinant Proteins | ||
STX19-16186M | Recombinant Mouse STX19 Protein | +Inquiry |
RFL34401HF | Recombinant Full Length Haemophilus Influenzae Uncharacterized Protein Hi_1736 (Hi_1736) Protein, His-Tagged | +Inquiry |
ACAA1A-87R | Recombinant Rat ACAA1A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBG1-2279H | Recombinant Human TUBG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEK-4273Z | Recombinant Zebrafish DEK | +Inquiry |
◆ Native Proteins | ||
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
AMY2A-8353H | Native Human AMY2A | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP1-2678HCL | Recombinant Human TIMP1 cell lysate | +Inquiry |
CENPT-7575HCL | Recombinant Human CENPT 293 Cell Lysate | +Inquiry |
RAB40B-2592HCL | Recombinant Human RAB40B 293 Cell Lysate | +Inquiry |
Spinalcord-626R | Rat Spinal cord whole Lysate, Total Protein | +Inquiry |
ZNF789-9HCL | Recombinant Human ZNF789 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Xenopus laevis UPF0668 protein C10orf76 homolog Products
Required fields are marked with *
My Review for All Xenopus laevis UPF0668 protein C10orf76 homolog Products
Required fields are marked with *
0
Inquiry Basket