Recombinant Full Length Xenopus Laevis Upf0458 Protein C7Orf42 Homolog Protein, His-Tagged
Cat.No. : | RFL551XF |
Product Overview : | Recombinant Full Length Xenopus laevis UPF0458 protein C7orf42 homolog Protein (Q2TAV2) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MILNLHPLENLKSYISSRPPLVIFMVSVSGMAIAFLTLGYFFKMKEIKSPGMTEDWNIFL LRFNNLDLCVSENETLKHFLNETTPPESTVTSGQARSSTQTPQALEDSGPINISVAITLT LDPLKPFGGYSRNITHLSSTIFGHQIGLSGRDSHEEMNITFTLPAAWNSDDCIVHGHCEQ VVFTTCMTVTAVTNVFPVTVQPPHCIPETYSNASLWYKIYTTARDSGTKNAQDYNPFWCY KGAIGKVYHALNPKLTVIVPEDDRSLINLHLMDTSYFLFVMVITMFCYAVIRGRPSKLRQ SKSEFLPEKVALSDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem248 |
Synonyms | tmem248; Transmembrane protein 248 |
UniProt ID | Q2TAV2 |
◆ Recombinant Proteins | ||
TCF21-5083C | Recombinant Chicken TCF21 | +Inquiry |
YSDB-0936B | Recombinant Bacillus subtilis YSDB protein, His-tagged | +Inquiry |
SEPT6-11904Z | Recombinant Zebrafish SEPT6 | +Inquiry |
RFL3472SF | Recombinant Full Length Synechococcus Sp. Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged | +Inquiry |
C11orf88-4354H | Recombinant Human C11orf88 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOP3B-1810HCL | Recombinant Human TOP3B cell lysate | +Inquiry |
HCAR3-737HCL | Recombinant Human HCAR3 cell lysate | +Inquiry |
Stomach-489H | Human Stomach Tumor Lysate | +Inquiry |
Skeletal Muscle-55H | Human Skeletal Muscle Tissue Lysate | +Inquiry |
GNA13-720HCL | Recombinant Human GNA13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem248 Products
Required fields are marked with *
My Review for All tmem248 Products
Required fields are marked with *
0
Inquiry Basket