Recombinant Full Length Mouse Upf0458 Protein C7Orf42 Homolog Protein, His-Tagged
Cat.No. : | RFL28484MF |
Product Overview : | Recombinant Full Length Mouse UPF0458 protein C7orf42 homolog Protein (Q3TBN1) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MFSINPLENLKLYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLL RFNDLDLCVSENETLKHLSNDTTTPESTMTVGQARSSTQPPQSLEESGPINISVAITLTL DPLKPFGGYSRNVTHLYSTILGHQIGLSGREAHEEINITFTLPAAWNADDCALHGHCEQA VFTACMTLTAAPGVFPVTVQPPHCIPDTYSNATLWYKIFTTARDANTKYAQDYNPFWCYK GAIGKVYHALNPKLTVVVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQS NPEFCPEKVALADA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem248 |
Synonyms | Tmem248; Transmembrane protein 248 |
UniProt ID | Q3TBN1 |
◆ Recombinant Proteins | ||
TTC39A-3587H | Recombinant Human TTC39A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPR65-709H | Recombinant Human GPR65 | +Inquiry |
Ubiquitin-06H | Recombinant Human Linear Tetra-ubiquitin Protein | +Inquiry |
Il18-53M | Active Recombinant Mouse Il18 Protein (Asn36-Ser192), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TRAL-2169S | Recombinant Staphylococcus aureus (strain: CDCGA672) TRAL protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-27332TH | Native Human APOC2 | +Inquiry |
IgG-119S | Native Sheep Immunoglobulin G | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPATA7-1531HCL | Recombinant Human SPATA7 293 Cell Lysate | +Inquiry |
PSMA2-2779HCL | Recombinant Human PSMA2 293 Cell Lysate | +Inquiry |
Colon-89G | Guinea Pig Colon Lysate | +Inquiry |
SSH2-1694HCL | Recombinant Human SSH2 cell lysate | +Inquiry |
PEX1-1335HCL | Recombinant Human PEX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem248 Products
Required fields are marked with *
My Review for All Tmem248 Products
Required fields are marked with *
0
Inquiry Basket