Recombinant Full Length Human Upf0458 Protein C7Orf42(C7Orf42) Protein, His-Tagged
Cat.No. : | RFL13419HF |
Product Overview : | Recombinant Full Length Human UPF0458 protein C7orf42(C7orf42) Protein (Q9NWD8) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MFSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLL RFNDLDLCVSENETLKHLTNDTTTPESTMTSGQARASTQSPQALEDSGPVNISVSITLTL DPLKPFGGYSRNVTHLYSTILGHQIGLSGREAHEEINITFTLPTAWSSDDCALHGHCEQV VFTACMTLTASPGVFPVTVQPPHCVPDTYSNATLWYKIFTTARDANTKYAQDYNPFWCYK GAIGKVYHALNPKLTVIVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQS NPEFCPEKVALAEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM248 |
Synonyms | TMEM248; C7orf42; Transmembrane protein 248 |
UniProt ID | Q9NWD8 |
◆ Recombinant Proteins | ||
TMEM248-4628R | Recombinant Rhesus Macaque TMEM248 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13419HF | Recombinant Full Length Human Upf0458 Protein C7Orf42(C7Orf42) Protein, His-Tagged | +Inquiry |
RFL4972XF | Recombinant Full Length Xenopus Tropicalis Upf0458 Protein C7Orf42 Homolog Protein, His-Tagged | +Inquiry |
TMEM248-4814R | Recombinant Rhesus monkey TMEM248 Protein, His-tagged | +Inquiry |
TMEM248-17023M | Recombinant Mouse TMEM248 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM248 Products
Required fields are marked with *
My Review for All TMEM248 Products
Required fields are marked with *
0
Inquiry Basket
There is no product in the inquiry basket.