Recombinant Full Length Xenopus Laevis Transmembrane Protein 120B-B(Tmem120B-B) Protein, His-Tagged
Cat.No. : | RFL13708XF |
Product Overview : | Recombinant Full Length Xenopus laevis Transmembrane protein 120B-B(tmem120b-b) Protein (Q6DE21) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MSLQKCQEEWGELEKEFQQLQETHKVYKQKLEELSSLQNLCSSYINKHKRRLTELKGNLH GYKHTSNLEEKELIQQIDGTIKERHNAFFDMEAYLPKKNSLYLNLVLGNVNVTLLSKQTK FAYKDEYEKFKLYLTIILLLGAITCRFVLHYRVTDEVFNFLLVWYFCTLTIRESILISNG SRIKGWWVSHHYVSTFLSGVMLTWPDGLMYQMFRNQFLAFSIFQSCVQFLQYYYQSGCLY RLRALGERNHLHLTVEGFQSWMWRGLTFLLPVLFFGHFWQLYNAMTLFGLSRHEECKEWQ VFVLALTFLLLFLGNFLTTLKVVHTKFQKNKLKKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem120b-b |
Synonyms | tmem120b-b; Transmembrane protein 120B-B |
UniProt ID | Q6DE21 |
◆ Recombinant Proteins | ||
YBXF-0412B | Recombinant Bacillus subtilis YBXF protein, His-tagged | +Inquiry |
COQ9-3795M | Recombinant Mouse COQ9 Protein | +Inquiry |
PLSCR3A-5991Z | Recombinant Zebrafish PLSCR3A | +Inquiry |
Retn-5466M | Recombinant Mouse Retn Protein | +Inquiry |
IAPP-6144HFL | Recombinant Full Length Human IAPP protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
PLP-21 | Native Mouse/Rat PLP (139-151) Protein | +Inquiry |
ELN-01H | Active Native Human ELN Protein | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAGE2B-468HCL | Recombinant Human PAGE2B lysate | +Inquiry |
PAEP-3470HCL | Recombinant Human PAEP 293 Cell Lysate | +Inquiry |
Stomach-147R | Rat Stomach Tissue Lysate | +Inquiry |
APOF-8779HCL | Recombinant Human APOF 293 Cell Lysate | +Inquiry |
NUBP2-3661HCL | Recombinant Human NUBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tmem120b-b Products
Required fields are marked with *
My Review for All tmem120b-b Products
Required fields are marked with *
0
Inquiry Basket