Recombinant Mouse Retn Protein

• Cat.No.: Retn-5466M
• Product Overview: Purified recombinant protein of Mouse resistin (Retn), transcript variant 1 without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
• Molecular Mass: 20.2 kDa
• AA Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Retn resistin [ Mus musculus (house mouse) ]
• Official Symbol: Retn
• Synonyms: RETN; resistin; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; dominant inhibitory adipocyte-specific secretory factor; adipose-specific cysteine-rich secreted protein A12-alpha; ADSF; Rstn; Xcp4; Fizz3
• Gene ID: 57264
• mRNA Refseq: NM_022984
• Protein Refseq: NP_075360
• UniProt ID: Q99P87