Recombinant Full Length Xenopus Laevis Protein Fam73A(Fam73A) Protein, His-Tagged
Cat.No. : | RFL19916XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein FAM73A(fam73a) Protein (Q6NRB7) (1-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-570) |
Form : | Lyophilized powder |
AA Sequence : | MTETQHIFRLTVHRFMDFPLSIYSSFTQLKPTPGLKKIIAVAAISGVSLIFLACHLKRKR GKKKINAPQTEPGQFILQCSRHVAEKGSSCSSSRQNLTLSLGSIKERGSQSHLNGDLCSK YSGSMQSLASVQSCHSCACINSNSWDKTDEDEINIPVTTPENLYLMGMELFEEALRRWEQ ALTFRSRQAEDEANCSSIKLGAGDAIAEENIEDVISADFIHKLEALLQRAYRLQEEFEAT LGASDPASLANDIDKDTDITVMDNGGDFQQRDTLSIASTDSFLSAAELADNQDMRATCGL DSLYHHALYEEAMQLAEEGKVHCRVLRTEMLECLGDSDFLAKLHCIRQAFQEIILQRENR IFLMGTGRKLLSALIVKARKNPKKFEDAYFDMMSFLEQPESWDTVEKELLSRGMKCMNFY DIVLDFIVMDSLEDLENPPLSIQNVVRNRWLNSSFKETAVTSSCWSVLRQKKQEMKVPNG FFANFYTVCEQLCPVLAWGFLGPRSSLHDLCCFYKAQIMYFLKDIFDFEKVRYSDVEHLA EDIMKCLQRRTELTVVYTGEESARRPPVLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | miga1 |
Synonyms | miga1; fam73a; Mitoguardin 1; Protein FAM73A |
UniProt ID | Q6NRB7 |
◆ Recombinant Proteins | ||
YKZR-2314B | Recombinant Bacillus subtilis YKZR protein, His-tagged | +Inquiry |
ATG4A-6522H | Recombinant Human ATG4A protein, His-tagged | +Inquiry |
EIF5-478H | Recombinant Human EIF5 Protein (1-431 aa), His-SUMO-tagged | +Inquiry |
SELL-7765Z | Recombinant Zebrafish SELL | +Inquiry |
BVES-410R | Recombinant Rhesus Macaque BVES Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUMB-3634HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
SP140-1675HCL | Recombinant Human SP140 cell lysate | +Inquiry |
ALPK1-8894HCL | Recombinant Human ALPK1 293 Cell Lysate | +Inquiry |
NHEJ1-3834HCL | Recombinant Human NHEJ1 293 Cell Lysate | +Inquiry |
CRYBA4-7263HCL | Recombinant Human CRYBA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All miga1 Products
Required fields are marked with *
My Review for All miga1 Products
Required fields are marked with *
0
Inquiry Basket