Recombinant Full Length Xenopus Laevis Potassium Channel Subfamily K Member 9(Kcnk9) Protein, His-Tagged
Cat.No. : | RFL3300XF |
Product Overview : | Recombinant Full Length Xenopus laevis Potassium channel subfamily K member 9(kcnk9) Protein (Q63ZI0) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MKRQNVRTLSLIICTFTYLLVGAAVFDALESDYEMREEEKLKAEEIRLKGKYNISSEDYR QLELVIMQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVKYLLKRIKKCCGMHSTDVSMENMVTVGFFSCMGTLCIGAAAFSH YEEWSFFQAYYYCFITLTTIGFGDYVALQKNRALQKKPLYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSEDERRDAEERASLAGNRNSMIIHIQEDTPHGRQRYKAEVTDLQSVCSCM CYRSHEYTSRMVSHQNSFSSKLNPQYFHSISYKIEEISPSTLKNSLFPSPVSSVSPGLHS FTDKHRLMKRRKSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kcnk9 |
Synonyms | kcnk9; Potassium channel subfamily K member 9 |
UniProt ID | Q63ZI0 |
◆ Recombinant Proteins | ||
CD1C-151H | Recombinant Human CD1C Protein, DYKDDDDK-tagged | +Inquiry |
METT11D1-832H | Recombinant Human METT11D1, GST-tagged | +Inquiry |
HLA-DOB-13815H | Recombinant Human HLA-DOB, GST-tagged | +Inquiry |
SCN11A-14752M | Recombinant Mouse SCN11A Protein | +Inquiry |
FLI1A-8931Z | Recombinant Zebrafish FLI1A | +Inquiry |
◆ Native Proteins | ||
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
Tyrosinase-39 | Native Tyrosinase, Enzyme Activity | +Inquiry |
TF-5341H | Native Human Transferring | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
P4HB-2121MCL | Recombinant Mouse P4HB cell lysate | +Inquiry |
GATSL3-6004HCL | Recombinant Human GATSL3 293 Cell Lysate | +Inquiry |
CDK2AP1-7628HCL | Recombinant Human CDK2AP1 293 Cell Lysate | +Inquiry |
TAGLN-1262HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kcnk9 Products
Required fields are marked with *
My Review for All kcnk9 Products
Required fields are marked with *
0
Inquiry Basket