Recombinant Full Length Xenopus Laevis Occludin(Ocln) Protein, His-Tagged
Cat.No. : | RFL1932XF |
Product Overview : | Recombinant Full Length Xenopus laevis Occludin(ocln) Protein (Q9PUN1) (1-493aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-493) |
Form : | Lyophilized powder |
AA Sequence : | MYSRPSNYAPSKDVYGGEMRSQPAYSYYPEEEIQHFYRWSSPPGIIKIMSILIVVMCVGI FACVASTLPWDLDITGQSMGYGMGSGSYSGGYTGYGFGGSQMGLGFAYGGNYTDPRAAKG FILAMAAFCFIIGLVIFVMLVTRTPLSTSRKFYLIVIIVSAIIGGLVFIATIVYTVGVNP VAQASGSAFYTQIVSICNQFYSPVQTGVFVNQYLYHYCVVEPQEAIAIVLGFLIVVAFAI IIFFAVKTRKKINQYGKTNILWKKNHIYEDGDPQVEQWVKNVAENSAPALSDYNEKVDGS VADYRSANGVQAYPSQNNISHPIAEEELPLKEDYGMSPRHYSSSSDATTKKAPPKKRPGK PRRSDLDTNEGGYNTGGESADELEDDSWDSEYPPITQTKQRQEYKQEFASDLHEYKRLQA ELDELSKIPVPSLNRELGQSSRKDSEEYRTVADKYNRLKEIKSSADYRNKKKRCKGLKTK LNHIKQMVSNYDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ocln |
Synonyms | ocln; Occludin |
UniProt ID | Q9PUN1 |
◆ Recombinant Proteins | ||
RFL2330RF | Recombinant Full Length Rat Occludin(Ocln) Protein, His-Tagged | +Inquiry |
OCLN-3859H | Recombinant Human OCLN Protein (Lys266-Thr522), His tagged | +Inquiry |
Ocln-425M | Recombinant Mouse Ocln Protein, His-tagged | +Inquiry |
RFL35773PF | Recombinant Full Length Potorous Tridactylus Occludin(Ocln) Protein, His-Tagged | +Inquiry |
OCLN-3815R | Recombinant Rat OCLN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCLN-3603HCL | Recombinant Human OCLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ocln Products
Required fields are marked with *
My Review for All ocln Products
Required fields are marked with *
0
Inquiry Basket