Recombinant Full Length Xenopus Laevis Glutamate Receptor U1(Kbp) Protein, His-Tagged
Cat.No. : | RFL17178XF |
Product Overview : | Recombinant Full Length Xenopus laevis Glutamate receptor U1(kbp) Protein (Q91756) (18-479aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-479) |
Form : | Lyophilized powder |
AA Sequence : | CTDAGESKGSIHKEKERSKRQALKHLTVTTIMEQPFSMKSESGMEGFCIDLLSELSQSLG FNYTIKEVKDGRYGAKDQDGNWNGMVGEVLRKEVDLAVAPLTITANRERELAFTKPFMQT GISILLRKEDASENSFLFGFLTPFSKETWIGILVAYMVTSLCLFLVGRLSPCEWTELSTE QNNFTFLNSLWFGAGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSD SVQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSF AEGVRRVRESNYAFLGESVMQDIMVAKHCELARAPQIIAGRGYGIAASIDSQLIKQLSIA ILEQTESGNIEYLRKKWWDNTCSMKRSAGWNPVQPHTLGGIFLILGIGLALGVIAALIEL VLKARNNADQQKKSCCSAFSEEMGERLGTNKENQGAVDSVKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kbp |
Synonyms | kbp; Glutamate receptor U1; Kainate-binding protein; Unitary non-NMDA glutamate receptor subunit 1; XENU1 |
UniProt ID | Q91756 |
◆ Native Proteins | ||
TTR-31108TH | Native Human TTR | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
LOC102577615-59P | Native potato LOC102577615 Protein | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-116M | Mouse Skin Tissue Lysate (14 Days Old) | +Inquiry |
TCEB3C-1185HCL | Recombinant Human TCEB3C 293 Cell Lysate | +Inquiry |
C20orf185-8122HCL | Recombinant Human C20orf185 293 Cell Lysate | +Inquiry |
KDR-1520MCL | Recombinant Mouse KDR cell lysate | +Inquiry |
ACAT2-9108HCL | Recombinant Human ACAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kbp Products
Required fields are marked with *
My Review for All kbp Products
Required fields are marked with *
0
Inquiry Basket