Recombinant Full Length Anas Platyrhynchos Probable Glutamate Receptor(Kbp) Protein, His-Tagged
Cat.No. : | RFL25851AF |
Product Overview : | Recombinant Full Length Anas platyrhynchos Probable glutamate receptor(KBP) Protein (Q90218) (24-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anas platyrhynchos (Mallard) (Anas boschas) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-487) |
Form : | Lyophilized powder |
AA Sequence : | AGAMRNDAAASKDTDLRGPEENLPTLTVTTILEDPYVMVRRAELEGYCIDLLKALASMLH FSYKVKVVGDGKYGAVSSNGNWTGMIGEILRQEADIAVAPLTVTSAREEVVSFTTPFLQT GIGILLRKDTMSQEMSFFHFLAPFSKETWTGLLFAYILTCFCLFLVARLSPCEWNEPKNE ENHFTFLNSLWFGAGALALQGVTPRPKALSVRVIAAIWWLFTIALLAAYIANFTALLSSG SEQLPIQTFEDLVKQRKLEFGTLDGSSTFYYFKNSKNPIHQMIYEYMDKRRDHVLVKTYQ EAVQRVMDSNYAFIGESISQDLAAARHCNLIRAPEVIGARGFGIATAQASPWTKKLSIAV LKLRESGDLDYLRNKWWETSCLHKSRERWSPLQPQALGGLFLTLAIGLALGVIAAVVELS NKSRHAAGHVKKSCCSIFTEEMCTRLRIKENTRQSQETSGRANA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KBP |
Synonyms | KBP; Probable glutamate receptor; Kainate-binding protein |
UniProt ID | Q90218 |
◆ Recombinant Proteins | ||
EGFR-464HAF647 | Active Recombinant Human EGFR Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
SV2A-16266M | Recombinant Mouse SV2A Protein | +Inquiry |
RFL23549SF | Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhg2(Mnhg2) Protein, His-Tagged | +Inquiry |
YUSU-4105B | Recombinant Bacillus subtilis YUSU protein, His-tagged | +Inquiry |
GSTCD-574C | Recombinant Cynomolgus GSTCD Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
F2-73R | Native Rat Prothrombin | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
Collagen-225B | Native Bovine Type IV Collagen Protein | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOT9-15HCL | Recombinant Human ACOT9 cell lysate | +Inquiry |
MINA-4313HCL | Recombinant Human MINA 293 Cell Lysate | +Inquiry |
MS4A8B-1138HCL | Recombinant Human MS4A8B cell lysate | +Inquiry |
DROSHA-423HCL | Recombinant Human DROSHA Lysate | +Inquiry |
LYAR-1040HCL | Recombinant Human LYAR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KBP Products
Required fields are marked with *
My Review for All KBP Products
Required fields are marked with *
0
Inquiry Basket