Recombinant Full Length Xenopus Laevis E3 Ubiquitin-Protein Ligase Rnf19B(Rnf19B) Protein, His-Tagged
Cat.No. : | RFL4243XF |
Product Overview : | Recombinant Full Length Xenopus laevis E3 ubiquitin-protein ligase RNF19B(rnf19b) Protein (Q08B84) (1-687aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-687) |
Form : | Lyophilized powder |
AA Sequence : | MRLRNDCLVRLLTSWFGIFCLYEMTEGSAEPPPCPGARRRRLLLSLPNVFPGRTRAAPEP SVPSPPPSPPPPPPPPVSVPPPPSSPGGSESLIECPLCLVRQPPEEIPELLSCRHRSCLR CLRQYLRIEICESRVNLRCPECAERLSPQHVRAILRDPLLTRKYEEFLLRRCLAADPDCR WCPAPDCGYAVIAYGCASCPKLTCEREGCRTEFCYHCKHVWHPNQTCDMARQQRAPSLGV RRKHPSGISYGQESGSADDMKSCPRCSAYIIKMNDGSCNHMTCSVCGCEFCWLCMKEISD LHYLSPSGCTFWGKKPWSRKKKIIWQLSTLIGAPVGISLIAGIAIPAMVIGIPVYVGRKI HGRFENKKTSRHKKNLAVTGGVILSVIASPVVAAVSVGIGVPIMLAYVYGVVPVSLCRGG GCGVTTANGKGVKIDFEEDGPITVADAWRALKNPSIGESSMEGLTSVLSTSGSPTDGLSV LQGNYSETASFAALAGGTLTGGMLSGGRAKYCRLEVQADVQKETCQKDSVSLGAVSDSAS TRAMAGSIISSYNPQEREVNNMEIQVHIEAKPSRYQLMSESSTEESLHASAPLVESEDAE ACRNQVAACDITLAQPESIRSDLESSDAQSDDVPDLASEEYDSPHLFPPSPSNALQESPP HRMCAQEEGLCAHEESLSKVEIIELRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rnf19b |
Synonyms | rnf19b; E3 ubiquitin-protein ligase RNF19B; RING finger protein 19B |
UniProt ID | Q08B84 |
◆ Recombinant Proteins | ||
TES-2782H | Recombinant Human TES, His-tagged | +Inquiry |
STC1-578H | Recombinant Human STC1 Protein, DDK/His-tagged | +Inquiry |
BB3856-2538B | Recombinant Bordetella Bronchiseptica BB3856 Protein (22-150 aa), His-Myc-tagged | +Inquiry |
Sostdc1-5785R | Recombinant Rat Sostdc1 protein, His-sumostar-tagged | +Inquiry |
Adpgk-1543M | Recombinant Mouse Adpgk Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GORAB-5830HCL | Recombinant Human GORAB 293 Cell Lysate | +Inquiry |
GPR50-746HCL | Recombinant Human GPR50 cell lysate | +Inquiry |
RIC8A-2340HCL | Recombinant Human RIC8A 293 Cell Lysate | +Inquiry |
ITM2C-5115HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
HOXB4-5423HCL | Recombinant Human HOXB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rnf19b Products
Required fields are marked with *
My Review for All rnf19b Products
Required fields are marked with *
0
Inquiry Basket