Recombinant Full Length Danio Rerio E3 Ubiquitin-Protein Ligase Rnf19B(Rnf19B) Protein, His-Tagged
Cat.No. : | RFL31299DF |
Product Overview : | Recombinant Full Length Danio rerio E3 ubiquitin-protein ligase RNF19B(rnf19b) Protein (Q1L8L6) (1-701aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-701) |
Form : | Lyophilized powder |
AA Sequence : | MGSEKDSESPHSSVSGIPNPKCRGPGKKQGRISFHSLFHSKRGPRGSKANVGTPLAQQLH QQQQIQQQQLLQPPTPTNVSSDPSTADPAEPLSTSQASLGGQELLECPLCLVRQPAEQLP ELQGCSHRSCLCCLRQYLRIEITESRVQLSCPECAERLAPWQVALILDDPNLMEKYEEFL LRRCLASDPDCRWCPAPDCGFAVIASGCASCPRLVCRREGCGAEFCYHCKQAWHPNQTCD SARQQRALSLRTHSNHSPSYTAEQGHTDDIKPCPRCGAYIIKMNDGSCNHMTCAVCGCEF CWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGITLIAGIAVPAMVI GIPVYIGRKIHSHYEGKKTSHHRRNLAITGGVALSIITAPVIAAVSVGIGVPIMLAYVYG VVPISLCRGGGCGVSRGKGRGVRIDFDEDDGPITVADAWRALKSPSLGESSLEGAASGLS TTSPSEGLSVAPGGLGDTPHFNTLAGGALGARTGKYSRLEVQGTELGKEVAGRETGSLGA ASDCASTRGMAGSITSSYTLPDREGTNLEIQVDIETKPSHLCLTTEEDLAPPTAAMAPGV GEEPQDCSSRRSRTVMDSPLGLSPGMSLREGLRDVTLAQPESIRSDLEMSDTQSDDIAEL TSDDCDSPHPKSCHGAPPQATCRALNPTDSLHCPDNVILYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rnf19b |
Synonyms | rnf19b; si:rp71-45k5.9; E3 ubiquitin-protein ligase RNF19B; RING finger protein 19B |
UniProt ID | Q1L8L6 |
◆ Recombinant Proteins | ||
DHFR-11966H | Recombinant Human DHFR, GST-tagged | +Inquiry |
RFL19993EF | Recombinant Full Length Escherichia Coli O7:K1 Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
FREM2A-7217Z | Recombinant Zebrafish FREM2A | +Inquiry |
YCGL-3866B | Recombinant Bacillus subtilis YCGL protein, His-tagged | +Inquiry |
RAB8B-222H | Recombinant Human RAB8B, member RAS oncogene family, His-tagged | +Inquiry |
◆ Native Proteins | ||
MB-30275TH | Native Human MB | +Inquiry |
COX1-31S | Active Native Sheep COX1 protein | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
B. abortus-23 | Native Brucella abortus Antigen | +Inquiry |
293T-01NE | Native HEK293 Nuclear Extract | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBP2-6315HCL | Recombinant Human FBP2 293 Cell Lysate | +Inquiry |
SLC22A9-1789HCL | Recombinant Human SLC22A9 293 Cell Lysate | +Inquiry |
AK4-8945HCL | Recombinant Human AK3L1 293 Cell Lysate | +Inquiry |
ZNF131-1985HCL | Recombinant Human ZNF131 cell lysate | +Inquiry |
IL18RAP-2602HCL | Recombinant Human IL18RAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rnf19b Products
Required fields are marked with *
My Review for All rnf19b Products
Required fields are marked with *
0
Inquiry Basket