Recombinant Full Length Xenopus Laevis Atpase Family Aaa Domain-Containing Protein 3-A(Atad3-A) Protein, His-Tagged
Cat.No. : | RFL16194XF |
Product Overview : | Recombinant Full Length Xenopus laevis ATPase family AAA domain-containing protein 3-A(atad3-a) Protein (Q58E76) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | MSWLFGLNKGQQEPPGVPGFPEPPSPPGGSGDGGDKNKPKDKWSNFDPTGLERAAKAARE LDQSRHAKEAINLAKVQEETLQMEQQAKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETK QHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEDSVQKQEAMRRATVEHEMELRHKN EMLRIEAEARAQAKVERENADIIREQIRLKAAEHRQTVLESIKTAGTVFGEGFRTFISDW DKVTATVAGLTLLAVGVYTAKNATGVAGRYIEARLGKPSLVRDTSRITVAEAVKHPIKIT KRLYSKIQDALEGVILSPRLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKK LAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEK ISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERL VRLYFDKYVLQPASEGKQRLKVAQFDYGKKCSELSKLTEGMSGREISKLGVAWQAAAYAS EDGILTEAMIDARVADAIRQHQQKMAWLKAEGKEGAKEIGKNPLQPLLEGTQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atad3-a |
Synonyms | atad3-a; ATPase family AAA domain-containing protein 3-A |
UniProt ID | Q58E76 |
◆ Recombinant Proteins | ||
NADK2-186H | Recombinant Human NADK2 Protein, MYC/DDK-tagged | +Inquiry |
RFL20533MF | Recombinant Full Length Mouse Linker For Activation Of T-Cells Family Member 1(Lat) Protein, His-Tagged | +Inquiry |
UNG-1019HFL | Recombinant Full Length Human UNG Protein, C-Flag-tagged | +Inquiry |
AOF2-643H | Recombinant Human AOF2 protein, GST-tagged | +Inquiry |
IL10-500M | Recombinant Mouse IL10 Protein | +Inquiry |
◆ Native Proteins | ||
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS8-4763HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
RFPL3-2404HCL | Recombinant Human RFPL3 293 Cell Lysate | +Inquiry |
Liver-287B | Bovine Liver Lysate | +Inquiry |
C6-1647HCL | Recombinant Human C6 cell lysate | +Inquiry |
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All atad3-a Products
Required fields are marked with *
My Review for All atad3-a Products
Required fields are marked with *
0
Inquiry Basket