Recombinant Full Length Xenopus Laevis Apelin Receptor B(Aplnr-B) Protein, His-Tagged
Cat.No. : | RFL21529XF |
Product Overview : | Recombinant Full Length Xenopus laevis Apelin receptor B(aplnr-b) Protein (Q2TAD5) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MESEGFSATTEQYEYYDYANETGLQPCDETDWDFSYSLLPVFYMIVFVLGLSGNGVVIFT VWKAKPKRRSADTYIGNLALADLAFVVTLPLWATYTALGFHWPFGSALCKLSSYLVLLNM FASVFCLTCLSFDRYLAIVHSLSSAKLRSRSSILVSLAVIWLFSGLLALPSLILRDTRVE GNNTICDLDFSGVSSKENENFWIGGLSILTTVPGFLLPLLLMTIFYCFIGGKVTMHFQNL KKEEQKKKRLLKIIITLVVVFAICWLPFHILKTIHFLDLMGFLELSCSAQNIIVSLHPYA TCLAYVNSCLNPFLYAFFDLRFRSQCFFFFGFKKVLQGHLSNTSSSLSAQTQKSEIHSLA TKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aplnr-b |
Synonyms | aplnr-b; agtrl1-b; agtrl1b; Apelin receptor B; Angiotensin receptor-like 1b; Angiotensin receptor-related protein B; G-protein coupled receptor APJ-B; APJb |
UniProt ID | Q2TAD5 |
◆ Recombinant Proteins | ||
GPR89B-1961R | Recombinant Rhesus monkey GPR89B Protein, His-tagged | +Inquiry |
RFL34521CF | Recombinant Full Length Guinea Pig Histamine H1 Receptor(Hrh1) Protein, His-Tagged | +Inquiry |
TMEM180-2892C | Recombinant Chicken TMEM180 | +Inquiry |
FRMD6-2939Z | Recombinant Zebrafish FRMD6 | +Inquiry |
MAP3K11-2486R | Recombinant Rhesus Macaque MAP3K11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-8344H | Native Human APOA1 | +Inquiry |
TcdA-188C | Active Native Clostridium difficile Toxin A Protein | +Inquiry |
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
C5b6-1537H | Active Native Human C5b,6 Complex Protein | +Inquiry |
GPT-65H | Active Native Human Glutamate Pyruvate Transaminase (GPT) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOC391746-1013HCL | Recombinant Human LOC391746 cell lysate | +Inquiry |
AMACR-8888HCL | Recombinant Human AMACR 293 Cell Lysate | +Inquiry |
ZFP64-178HCL | Recombinant Human ZFP64 293 Cell Lysate | +Inquiry |
THPO-2831MCL | Recombinant Mouse THPO cell lysate | +Inquiry |
NEUROG1-3865HCL | Recombinant Human NEUROG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aplnr-b Products
Required fields are marked with *
My Review for All aplnr-b Products
Required fields are marked with *
0
Inquiry Basket