Recombinant Full Length Xanthomonas Campestris Pv. Vesicatoria C4-Dicarboxylate Transport Protein(Dcta) Protein, His-Tagged
Cat.No. : | RFL6625XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. vesicatoria C4-dicarboxylate transport protein(dctA) Protein (Q3BPI3) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas campestris pv. vesicatoria |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MHISKPAGPLPASVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII APVIFLTIVTGIAGMTHLKTVGRVFGKAMAYFLFFSTLALVVGLVVAHVVQPGAGMNINP ADLDQSAVKSYVEKSHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVL FGVSLALVGERGKPVLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNL AWLVGSFYLTSLLFVLVILGLVSRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEK MEKAGCEKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLS SKGAAGVTGAGFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVS RWENALDRDRLKLVLDGGEPPLLAPVGQPGVAPASLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctA |
Synonyms | dctA; XCV3599; C4-dicarboxylate transport protein |
UniProt ID | Q3BPI3 |
◆ Native Proteins | ||
Chylomicrons-193H | Native Human Chymotrypsin | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
Ceruloplasmin-019B | Active Native Bovine Ceruloplasmin Protein | +Inquiry |
IgG-352G | Native HAMSTER IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVRL1-994CCL | Recombinant Canine ACVRL1 cell lysate | +Inquiry |
SCNN1B-2028HCL | Recombinant Human SCNN1B 293 Cell Lysate | +Inquiry |
DUSP3-001HCL | Recombinant Human DUSP3 cell lysate | +Inquiry |
AZU1-3083HCL | Recombinant Human AZU1 cell lysate | +Inquiry |
Whole Eye-78H | Human Whole Eye Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dctA Products
Required fields are marked with *
My Review for All dctA Products
Required fields are marked with *
0
Inquiry Basket