Recombinant Full Length Xanthomonas Campestris Pv. Campestris Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL25944XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris Membrane protein insertase YidC(yidC) Protein (Q4UNK8) (1-573aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-573) |
Form : | Lyophilized powder |
AA Sequence : | MNQTRVFLIFAWLMVAALLWMEWGKDKAPANAPTPIASQAVPAARDPDAAAPAANVPSAQ AIPQAGSPAAVPATSTTTATPATTGAAPAITLTSDVLRLKLDGRSVLDAELLQFPQTKDG TEPVKLLTEDAAHPYNATSGWASERSPVPGVGGFRAEQPGTTFELAKGQNTLVVPFVWNG PNGVSIRRIFTLQRGSYAISIKDEVINKSDAAWNGYVFRKLSRVPTILSRGMTNPDSFSF NGATWYSPQEGYERRAFKDYMDDGGLNRQITGGWVALLQHHFFTAWIPQKDQASLYVLAQ DGPRDVAELRGPAFTVAPGQSASTEARLWVGPKLVSLLAKEDVKGLDRVVDYSRFSIMAI IGQGLFWVLSHLHSFLHNWGWAIIGLVVLLRLALYPLSAAQYKSGAKMRRFQPRLAQLKE RYGDDRQKYQQATMELFKKEKINPMGGCLPLLIQMPIFFALYWVLVESVELRQAPWLGWI QDLTARDPYFILPVLNIAIMWATQKLTPTPGMDPMQAKMMQFMPLVFGVMMAFMPAGLVL YWVVNGGLGLLIQWWMIRQHGEKPSKIIQANAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; XC_4330; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q4UNK8 |
◆ Native Proteins | ||
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM10-797HCL | Recombinant Human TRIM10 293 Cell Lysate | +Inquiry |
MID2-4319HCL | Recombinant Human MID2 293 Cell Lysate | +Inquiry |
SMYD1-1645HCL | Recombinant Human SMYD1 293 Cell Lysate | +Inquiry |
CTSE-2190MCL | Recombinant Mouse CTSE cell lysate | +Inquiry |
DPYSL4-508HCL | Recombinant Human DPYSL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket