Recombinant Full Length Burkholderia Mallei Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL33752BF |
Product Overview : | Recombinant Full Length Burkholderia mallei Membrane protein insertase YidC(yidC) Protein (Q62EM4) (1-558aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Mallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-558) |
Form : | Lyophilized powder |
AA Sequence : | MDIKRTVLWVIFFMSAVMLFDNWQRSHGRPSMFFPNVTQTNTASNATNGNGASGASAAAA ANALPAAATGAAPATTAPAAQAQLVRFSTDVYNGEIDTRGGTLAKLTLTKAGDGKQPDLS VTLFDHTANHTYLARTGLLGGDFPNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKV VKTYTFTRGSYVIGVDTKIENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQ KHFQKITFGDIDKNKADYVTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDPTLYRV GVKQPVEAIAPGQSADVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEK IHGFVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNA ALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFI LPVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQ QYYITRTLGGAAAKKKAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; BMA3397; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q62EM4 |
◆ Native Proteins | ||
HRP-002 | HRP, Rhodamine labeled | +Inquiry |
PLG-54H | Native Human glu-Plasminogen | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
ITGA3-5134HCL | Recombinant Human ITGA3 293 Cell Lysate | +Inquiry |
SLC45A2-1634HCL | Recombinant Human SLC45A2 cell lysate | +Inquiry |
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
LSM4-9173HCL | Recombinant Human LSM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket