Recombinant Full Length Xanthomonas Campestris Pv. Campestris Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL10987XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris Membrane protein insertase YidC(yidC) Protein (B0RMM6) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MNQTRVFLIFAWLMVAALLWMEWGKDKAAANAPTPIASQAVPAARDPDAAAPAANVPSAQ AIPQAGSPAAVPGTSTTTATATPVAAGAAPAITLTSDVLRLKLDGRSVLDAELLQFPQTK DGTEPVKLLTEDAAHPYNATSGWASERSPVPGVGGFRAEQPGTTFELAKGQNTLVVPFVW NGPNGVSIRRIFTLQRGSYAISIKDEVINKSDAAWNGYVFRKLSRVPTILSRGMTNPDSF SFNGATWYSPQEGYERRAFKDYMDDGGLNRQITGGWVALLQHHFFTAWIPQKDQASLYVL AQDGPRDVAELRGPAFTVAPGQSASTEARLWVGPKLVSLLAKEDVKGLDRVVDYSRFSIM AIIGQGLFWVLSHLHSFLHNWGWAIIGLVLLLRLALYPLSAAQYKSGAKMRRFQPRLAQL KERYGDDRQKYQQATMELFKKEKINPMGGCLPLLIQMPIFFALYWVLVESVELRQAPWLG WIQDLTARDPYFILPVLNIAIMWATQKLTPTPGMDPMQAKMMQFMPLVFGVMMAFMPAGL VLYWVVNGGLGLLIQWWMIRQHGEKPSKIIQANAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; xcc-b100_4466; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B0RMM6 |
◆ Recombinant Proteins | ||
ABCB11-1088M | Recombinant Mouse ABCB11 Protein | +Inquiry |
CD40-174HF | Recombinant Human CD40 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
SH-RS06630-5660S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS06630 protein, His-tagged | +Inquiry |
CCKAR-2956M | Recombinant Mouse CCKAR Protein | +Inquiry |
NIT2-26965TH | Recombinant Human NIT2, His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-262H | Native Human Transferrin | +Inquiry |
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
20S Immunoproteasome-224C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
PLD-19S | Active Native Streptomyces sp. Phospholipase D, Type VII | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD84-1733MCL | Recombinant Mouse CD84 cell lysate | +Inquiry |
FOXO3-6148HCL | Recombinant Human FOXO3 293 Cell Lysate | +Inquiry |
VDAC2-418HCL | Recombinant Human VDAC2 293 Cell Lysate | +Inquiry |
RUNX2-2107HCL | Recombinant Human RUNX2 293 Cell Lysate | +Inquiry |
FRMPD2B-285HCL | Recombinant Human FRMPD2L2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket