Recombinant Full Length Xanthomonas Axonopodis Pv. Citri Upf0761 Membrane Protein Xac0937(Xac0937) Protein, His-Tagged
Cat.No. : | RFL10374XF |
Product Overview : | Recombinant Full Length Xanthomonas axonopodis pv. citri UPF0761 membrane protein XAC0937(XAC0937) Protein (Q8PNV2) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas axonopodis pv. citri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MNKLHQWKERLRDRARTVSFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFGVLS AFPAFNEWKDALTDFIFNNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLITLHS IEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQWLA EFAWRLAPMAVEFVCIVLIYRVVPQHVVRLRHALPGALLAVILMEIVKWGFGFYLGNFQT YQRIYGALSALPILLLWIYLSWVSVLLGASLASSMSAFRYQPEAMRLPPGFEIYGLLRLL GRFSQARVHGDGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERGQWLLARDLDVV PLAELYENCQLRVPIEDRPLPCRDDAFGQAAAAALEQLRQPLRSVLAQPVGDLYTHLPGD PP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | XAC0937 |
Synonyms | XAC0937; UPF0761 membrane protein XAC0937 |
UniProt ID | Q8PNV2 |
◆ Recombinant Proteins | ||
RPS15-4810R | Recombinant Rat RPS15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDH1A1-01H | Active Recombinant Human ALDH1A1 Protein | +Inquiry |
FBXO32-4670HF | Recombinant Full Length Human FBXO32 Protein, GST-tagged | +Inquiry |
RFL27826OF | Recombinant Full Length Rabbit Calcitonin Receptor(Calcr) Protein, His-Tagged | +Inquiry |
Spike-4724V | Active Recombinant COVID-19 Spike RBD protein, mFc-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
GC-198H | Native Human GC-Globulin | +Inquiry |
ALPL-66C | Active Native Calf Alkaline Phosphatase | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
IGHA2 -19H | Native Human IgA2 | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
Diencephalons-106R | Rhesus monkey Diencephalons Lysate | +Inquiry |
PTPDC1-2690HCL | Recombinant Human PTPDC1 293 Cell Lysate | +Inquiry |
DDX31-7010HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
TFB1M-1136HCL | Recombinant Human TFB1M 293 Cell Lysate | +Inquiry |
FAM71B-585HCL | Recombinant Human FAM71B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XAC0937 Products
Required fields are marked with *
My Review for All XAC0937 Products
Required fields are marked with *
0
Inquiry Basket