Recombinant Full Length Human FBXO32 Protein, GST-tagged

• Cat.No.: FBXO32-4670HF
• Product Overview: Human FBXO32 full-length ORF ( AAH24030.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.84 kDa
• Protein length: 210 amino acids
• AA Sequence: MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXO32 F-box protein 32 [ Homo sapiens ]
• Official Symbol: FBXO32
• Synonyms: FBXO32; F-box protein 32; F box only protein 32; F-box only protein 32; ATROGIN1; Fbx32; MAFbx; atrogin 1; atrogin-1; muscle atrophy F-box protein; FLJ32424; MGC33610
• Gene ID: 114907
• mRNA Refseq: NM_001242463
• Protein Refseq: NP_001229392
• MIM: 606604
• UniProt ID: Q969P5