Recombinant Full Length Virulence Sensor Histidine Kinase Phoq(Phoq) Protein, His-Tagged
Cat.No. : | RFL27504SF |
Product Overview : | Recombinant Full Length Virulence sensor histidine kinase PhoQ(phoQ) Protein (Q8Z7H3) (1-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-487) |
Form : | Lyophilized powder |
AA Sequence : | MNKFARHFLPLSLRVRFLLATAGVVLVLSLAYGIVALVGYSVSFDKTTFRLLRGESNLFY TLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFH EIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATTRMPQLTIVVVDT IPIELKRSYMVWSWFVYVLAANLLLVIPLLWIAAWWSLRPIEALAREVRELEDHHREMLN PETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSV SKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKG VNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPG IPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQ HPTQKEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | phoQ |
Synonyms | phoQ; STY1270; t1690; Virulence sensor histidine kinase PhoQ; Sensor histidine protein kinase/phosphatase PhoQ |
UniProt ID | Q8Z7H3 |
◆ Recombinant Proteins | ||
Myo1b-2470R | Recombinant Rat Myo1b Protein, His-tagged | +Inquiry |
RAB32A-11479Z | Recombinant Zebrafish RAB32A | +Inquiry |
gH-4262H | Recombinant Human herpesvirus 4 gH protein, His-SUMO-tagged | +Inquiry |
RFL27400MF | Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0971(Mj0971) Protein, His-Tagged | +Inquiry |
WDR6-18487M | Recombinant Mouse WDR6 Protein | +Inquiry |
◆ Native Proteins | ||
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
NA-003H9N2CL | Recombinant H9N2 NA cell lysate | +Inquiry |
MGMT-1109HCL | Recombinant Human MGMT cell lysate | +Inquiry |
PLA2G4C-3140HCL | Recombinant Human PLA2G4C 293 Cell Lysate | +Inquiry |
GRIA3-752HCL | Recombinant Human GRIA3 cell lysate | +Inquiry |
PPT1-001HCL | Recombinant Human PPT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All phoQ Products
Required fields are marked with *
My Review for All phoQ Products
Required fields are marked with *
0
Inquiry Basket