Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0971(Mj0971) Protein, His-Tagged
Cat.No. : | RFL27400MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0971(MJ0971) Protein (Q58381) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MNMDTSKVILIVAIIIWIILYSIRDSINLKTYGGIFGILRTKLGLKTIEKLGKYKIWQKI GIISIPICVILGFFMLLNIIDMSIRLLSGTLPKEAAKPVVFLFGDVIPWIPGIIALLIAI SVHELAHGIFAKSFGIKVKSSGILLLLGLPLGAFVELGDEFKTADKKIRGAIASAGPLAN LIIFLTSIPLLSFSYTLPTELKIIDVKEPASEFLQKGDIIYEINGKKINSLEDFKEFAKT IEPKKEYEIKILRDNKILTYKIVSSNEGKLGIMVSPTKNTALFINTIYWTYWFNFLLALF NLLPAMPLDGFHVWNAFPELLKERKNRFISKVGQILELFINEKTLGSITLLVWWVILGSI LYSMW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0971 |
Synonyms | MJ0971; Uncharacterized protein MJ0971 |
UniProt ID | Q58381 |
◆ Recombinant Proteins | ||
ADAMTSL5-5732H | Recombinant Human ADAMTSL5 protein, His&Myc-tagged | +Inquiry |
IL7-2380H | Recombinant Human IL7 protein, His-SUMO-tagged | +Inquiry |
CRYZ-3595C | Recombinant Chicken CRYZ | +Inquiry |
RFL14566MF | Recombinant Full Length Mouse Fun14 Domain-Containing Protein 1(Fundc1) Protein, His-Tagged | +Inquiry |
EXTL1-3587H | Recombinant Human EXTL1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Thromboplastin-079B | Native Bovine Thromboplastin Protein | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
Plasmin-250H | Active Native Human Plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLT1B-301HCL | Recombinant Human GOLT1B lysate | +Inquiry |
RECK-1490HCL | Recombinant Human RECK cell lysate | +Inquiry |
PITRM1-1357HCL | Recombinant Human PITRM1 cell lysate | +Inquiry |
IL1RAPL1-1688MCL | Recombinant Mouse IL1RAPL1 cell lysate | +Inquiry |
SLAMF6-2108MCL | Recombinant Mouse SLAMF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0971 Products
Required fields are marked with *
My Review for All MJ0971 Products
Required fields are marked with *
0
Inquiry Basket