Recombinant Full Length Vibrio Splendidus Upf0761 Membrane Protein Vs_0126 (Vs_0126) Protein, His-Tagged
Cat.No. : | RFL18225VF |
Product Overview : | Recombinant Full Length Vibrio splendidus UPF0761 membrane protein VS_0126 (VS_0126) Protein (B7VHE7) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio tasmaniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MNELPGSYKLKIKKAATGSIQFSRYLLTRMTHDRVNVNAGYLAYITLLSIVPMLTVLLSI LSSFSVFADVGLVIQNFVITNFVPASGDAVHGALLEFVANTGKMTAVGSVFLFIAALMLI SNIDKNLNYIWRVTEKRRAVLSFSMYWMVLTLGPILIGASIAATSYVTSLNLLQNEVVSS AFNTVIRKLPLITSFFAFFGLYLLVPNKKIHFSHAAAGSLVAALLFELSKKGFAAYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEQEQWSDSQEMVHSSDKDKITE QGNNSDSTDPESK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VS_0126 |
Synonyms | VS_0126; UPF0761 membrane protein VS_0126 |
UniProt ID | B7VHE7 |
◆ Recombinant Proteins | ||
EGFR-02H | Active Recombinant Human EGFR(T790M C797S L858R) protein, GST-tagged | +Inquiry |
TUT1-17641M | Recombinant Mouse TUT1 Protein | +Inquiry |
NPL-6626HF | Recombinant Full Length Human NPL Protein, GST-tagged | +Inquiry |
ZNF581-31743TH | Recombinant Human ZNF581 | +Inquiry |
LIF-134H | Active Recombinant Human LIF protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
Proteasome 20S-37H | Native Human Proteasome 20S Protein, Tag Free | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
CES2-2139HCL | Recombinant Human CES2 cell lysate | +Inquiry |
TRPV1-735HCL | Recombinant Human TRPV1 293 Cell Lysate | +Inquiry |
KRT36-955HCL | Recombinant Human KRT36 cell lysate | +Inquiry |
ACRV1-2105HCL | Recombinant Human ACRV1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VS_0126 Products
Required fields are marked with *
My Review for All VS_0126 Products
Required fields are marked with *
0
Inquiry Basket