Recombinant Full Length Human NPL Protein, GST-tagged

Cat.No. : NPL-6626HF
Product Overview : Human NPL full-length ORF ( AAH58003.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : N-acetylneuraminate pyruvate lyase (EC 4.1.3.3) controls the cellular concentration of sialic acid by catalyzing the conversion of sialic acid into acylmannosamines and pyruvate (Wu et al., 2005 [PubMed 16147865]).[supplied by OMIM
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 53.2 kDa
Protein length : 240 amino acids
AA Sequence : MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEFCIQRFINFVVKLENSKLKVSKNQRTLPLGTTNFPFLH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPL N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) [ Homo sapiens ]
Official Symbol NPL
Synonyms NPL; N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase); C1orf13, chromosome 1 open reading frame 13; N-acetylneuraminate lyase; DHDPS1; dihydrodipicolinate synthetase homolog 1 (E. coli); NPL1; NALase; sialic acid aldolase; sialate-pyruvate lyase; N-acetylneuraminic acid aldolase; dihydrodipicolinate synthetase homolog 1; NAL; C112; C1orf13; MGC61869; MGC149582;
Gene ID 80896
mRNA Refseq NM_001200050
Protein Refseq NP_001186979
MIM 611412
UniProt ID Q9BXD5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NPL Products

Required fields are marked with *

My Review for All NPL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon