Recombinant Full Length Vibrio Cholerae Serotype O1 Type Iv Pilin Assembly Protein Pilc(Pilc) Protein, His-Tagged
Cat.No. : | RFL33279VF |
Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 Type IV pilin assembly protein PilC(pilC) Protein (Q9X4G9) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio cholerae serotype O1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MKATQTLPLKNYRWKGINSNGKKVSGQMLAISEIEVRDKLKDQHIQIKKLKKGSVSLLAR LTHRVKSKDITILTRQLATMLTTGVPIVQALKLVGDNHRKAEMKSILAQITKSVEAGTPL SKAMRTASAHFDTLYVDLVETGEMSGNLPEVFERLATYREKSEQLRAKVIKALIYPSMVV LVALGVSYLMLTMVIPEFESMFKGFGAELPWFTQQVLKLSHWVQAYSLWAFIAIAAAIFG LKALRKNSFQIRLKTSRLGLKFPIIGNVLAKASIAKFSRTLATSFAAGIPILASLKTTAK TSGNVHFETAINEVYRDTAAGMPMYIAMRNTEAFPEMVLQMVMIGEESGQLDDMLNKVAT IYEFEVDNTVDNLGKILEPLIIVFLGTVVGGLVVAMYLPIFNLMSVLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pilC |
Synonyms | pilC; VC_2425; Type IV pilin assembly protein PilC; Type IV-A pilus assembly protein PilC |
UniProt ID | Q9X4G9 |
◆ Recombinant Proteins | ||
RFL12452EF | Recombinant Full Length Enterobacteria Phage F1 Attachment Protein G3P(Iii) Protein, His-Tagged | +Inquiry |
CPM-660H | Active Recombinant Human CPM protein, His-tagged | +Inquiry |
CD3E&CD3G-794H | Recombinant Human CD3E&CD3G protein, His-tagged | +Inquiry |
Avil-3228M | Recombinant Mouse Avil, His-tagged | +Inquiry |
ATG14-2512H | Recombinant Human ATG14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
Lectin-1867W | Active Native Succinylated Wheat Germ Agglutinin Protein | +Inquiry |
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
HBA2-27784TH | Native Human HBA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNG4-5061HCL | Recombinant Human KCNG4 293 Cell Lysate | +Inquiry |
NMT2-3782HCL | Recombinant Human NMT2 293 Cell Lysate | +Inquiry |
ADAMTSL1-001HCL | Recombinant Human ADAMTSL1 cell lysate | +Inquiry |
TBC1D28-1223HCL | Recombinant Human TBC1D28 293 Cell Lysate | +Inquiry |
MYO1C-4009HCL | Recombinant Human MYO1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pilC Products
Required fields are marked with *
My Review for All pilC Products
Required fields are marked with *
0
Inquiry Basket