Recombinant Full Length Pseudomonas Aeruginosa Type 4 Fimbrial Assembly Protein Pilc(Pilc) Protein, His-Tagged
Cat.No. : | RFL27061PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Type 4 fimbrial assembly protein PilC(pilC) Protein (P22609) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MLVKAHLRKQGINPLKVRKKGISLLGAGKKVKPMDIALFTRQMATMMGAGVPLLQSFDII GEGFDNPNMRKLVDEIKQEVSSGNSLANSLRKKPQYFDELYCNLVDAGEQSGALENLLDR VATYKEKTESLKAKIRKAMTYPIAVIIVALIVSAILLIKVVPQFQSVFQGFGAELPAFTQ MVVNLSEFLQEWWLAVIVGVGAIGFTFKELHKRSKKFRDTLDRTILKLPIFGGIVYKSAV ARYARTLSTTFAAGVPLVDALDSVSGATGNIVFKNAVSKIKQDVSTGMQLNFSMRTTSVF PNMAIQMTAIGEESGSLDEMLSKVASYYEEEVDNAVDNLTTLMEPMIMAVLGVLVGGLIV AMYLPIFQLGNVVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pilC |
Synonyms | pilC; PA4527; Type IV pilus assembly protein PilC |
UniProt ID | P22609 |
◆ Native Proteins | ||
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
SRC-29697TH | Native Human SRC | +Inquiry |
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Occipital Lobe-150H | Human Fetal Occipital Lobe Lysate | +Inquiry |
SSU72-1451HCL | Recombinant Human SSU72 293 Cell Lysate | +Inquiry |
SKI-1815HCL | Recombinant Human SKI 293 Cell Lysate | +Inquiry |
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
MRS2-67HCL | Recombinant Full Length Human MRS2 overexpression lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pilC Products
Required fields are marked with *
My Review for All pilC Products
Required fields are marked with *
0
Inquiry Basket