Recombinant Full Length Venezuelan Equine Encephalitis Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL33149VF |
Product Overview : | Recombinant Full Length Venezuelan equine encephalitis virus Structural polyprotein Protein (P36331) (813-1254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VEEV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (813-1254) |
Form : | Lyophilized powder |
AA Sequence : | YEHATTMPNQVGIPYNTIVNRAGYAPLPISIVPTKVKLIPTVNLEYITCHYKTGMDSPAI KCCGTQECSPTYRPDEQCKVFSGVYPFMWGGAYCFCDTENTQISKAYVTKSEDCVTDHAQ AYKAHTASVQAFLNITVGGHSTTAVVYVNGETPVNFNGVKLTAGPLSTAWSPFDKKIVQY AGEIYNYDFPEYGAGHAGAFGDIQARTISSSDVYANTNLVLQRPKAGAIHVPYTQAPSGY EQWKKDKPPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSTAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEAAVELAEQGSATIHFSTAS IHPEFRLQICTSYVTCKGDCHPPKDHIVTHPQYHAQSFTAAVSKTAWTWLTSLLGGSAII IIIGLVLATIVAMYVLTNQKHN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Venezuelan equine encephalitis virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | P36331 |
◆ Native Proteins | ||
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
GOT-185H | Active Native Human Glutamate Oxaloacetate Tranasminase | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf56-8100HCL | Recombinant Human C21orf56 293 Cell Lysate | +Inquiry |
USP7-672HCL | Recombinant Human USP7 cell lysate | +Inquiry |
EBNA1BP2-6734HCL | Recombinant Human EBNA1BP2 293 Cell Lysate | +Inquiry |
CYP2A7-7116HCL | Recombinant Human CYP2A7 293 Cell Lysate | +Inquiry |
HMG20A-5482HCL | Recombinant Human HMG20A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Venezuelan equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
My Review for All Venezuelan equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket