Recombinant Full Length Vaccinia Virus Protein F9 (F9) Protein, His-Tagged
Cat.No. : | RFL29862VF |
Product Overview : | Recombinant Full Length Vaccinia virus Protein F9 (F9) Protein (P68453) (1-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VACV |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-212) |
Form : | Lyophilized powder |
AA Sequence : | MAETKEFKTLYNLFIDSYLQKLAQHSIPTNVTCAIHIGEVIGQFKNCALRITNKCMSNSR LSFTLMVESFIEVISLLPEKDRRAIAEEIGIDLDDVPSAVSKLEKNCNAYAEVNNIIDIQ KLDIGECSAPPGQHMLLQIVNTGSAEANCGLQTIVKSLNKIYVPPIIENRLPYYDPWFLV GVAIILVIFTVAICSIRRNLALKYRYGTFLYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F9 |
Synonyms | F9; Protein F9 |
UniProt ID | P68453 |
◆ Recombinant Proteins | ||
F9-2502H | Recombinant Human F9 protein(51-120 aa), C-His-tagged | +Inquiry |
F9-312R | Recombinant Rat F9 protein, His-tagged | +Inquiry |
F9-1838R | Recombinant Rat F9 Protein, His (Fc)-Avi-tagged | +Inquiry |
F9-4418HF | Recombinant Full Length Human F9 Protein, GST-tagged | +Inquiry |
F9-1358R | Recombinant Rhesus Macaque F9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
F9-26523TH | Native Human F9 | +Inquiry |
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
F9-266B | Active Native Bovine Factor IX | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
F9-301R | Native Rat Factor IXa | +Inquiry |
◆ Cell & Tissue Lysates | ||
F9-1849HCL | Recombinant Human F9 cell lysate | +Inquiry |
F9-1768MCL | Recombinant Mouse F9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F9 Products
Required fields are marked with *
My Review for All F9 Products
Required fields are marked with *
0
Inquiry Basket