Recombinant Full Length Ustilago Maydis Pheromone Receptor 1(Pra1) Protein, His-Tagged
Cat.No. : | RFL9630UF |
Product Overview : | Recombinant Full Length Ustilago maydis Pheromone receptor 1(PRA1) Protein (P31302) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ustilago maydis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MLDHITPFFALVAFFLVLMPFAWHIKSKNVGLIMLSIWLMLGNLDNFVNSMVWWKTTADL APAYCELSVRLRHLLFIAIPASNLAIARKLESIASTRQVRAGPGDHRRAVIIDLLICLGI PIIYTSLMIVNQSNRYGILEEAGCWPMMVFSWLWVLLVAAPVIVVSLCSAVYSALAFRWF WVRRRQFQAVLASSASTINRSHYVRLLLLTAIDMLLFFPIYVGTIAAQIKSSISIPYGSW SSVHTGFNQIPQYPASLVLMENTFQRNLILARLVCPLSAYIFFAMFGLGLEVRQGYKEAF HRALLFCRLRKEPKASALQHVVADIEVVTFRSHDTFDANTSTKSEKSDIDMRGSEAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRA1 |
Synonyms | PRA1; UMAG_02383; Pheromone receptor 1 |
UniProt ID | P31302 |
◆ Recombinant Proteins | ||
RFL23166RF | Recombinant Full Length Rat Vomeronasal Type-1 Receptor A12(V1Ra12) Protein, His-Tagged | +Inquiry |
IGFBP1-3007R | Recombinant Rat IGFBP1 Protein | +Inquiry |
NDRG1-3929R | Recombinant Rat NDRG1 Protein | +Inquiry |
MAGI1B-1633Z | Recombinant Zebrafish MAGI1B | +Inquiry |
RFL8801SF | Recombinant Full Length Rhizobium Sp. Probable Chemoreceptor Y4Si (Ngr_A01640) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
IGHA-209H | Native Human Immunoglobulin A (IgA) | +Inquiry |
LTF-4771H | Native Human Lactotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf70-8337HCL | Recombinant Human C11orf70 293 Cell Lysate | +Inquiry |
Small Intestine-458H | Human Small Intestine Membrane Tumor Lysate | +Inquiry |
CEP57-7572HCL | Recombinant Human CEP57 293 Cell Lysate | +Inquiry |
CHCHD1-7546HCL | Recombinant Human CHCHD1 293 Cell Lysate | +Inquiry |
C21orf2-237HCL | Recombinant Human C21orf2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRA1 Products
Required fields are marked with *
My Review for All PRA1 Products
Required fields are marked with *
0
Inquiry Basket