Recombinant Full Length Chicken Green-Sensitive Opsin(Pra1) Protein, His-Tagged
Cat.No. : | RFL7192GF |
Product Overview : | Recombinant Full Length Chicken Green-sensitive opsin(PRA1) Protein (P28683) (1-355aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-355) |
Form : | Lyophilized powder |
AA Sequence : | MNGTEGINFYVPMSNKTGVVRSPFEYPQYYLAEPWKYRLVCCYIFFLISTGLPINLLTLL VTFKHKKLRQPLNYILVNLAVADLFMACFGFTVTFYTAWNGYFVFGPVGCAVEGFFATLG GQVALWSLVVLAIERYIVVCKPMGNFRFSATHAMMGIAFTWVMAFSCAAPPLFGWSRYMP EGMQCSCGPDYYTHNPDYHNESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQES ATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAFWIFTNKGADFTATLMAVPAFFSKSSSL YNPIIYVLMNKQFRNCMITTICCGKNPFGDEDVSSTVSQSKTEVSSVSSSQVSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRA1 |
Synonyms | PRA1; Green-sensitive opsin; Green cone photoreceptor pigment |
UniProt ID | P28683 |
◆ Recombinant Proteins | ||
Ccn5-2047M | Recombinant Mouse Ccn5 Protein, Myc/DDK-tagged | +Inquiry |
NEU1-580H | Recombinant Human NEU1 protein, His-tagged | +Inquiry |
RGS16-30743TH | Recombinant Human RGS16, His-tagged | +Inquiry |
Arid4b-3681M | Recombinant Mouse Arid4b, His-tagged | +Inquiry |
DUX5-4134HF | Recombinant Full Length Human DUX5 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-332S | Native Swine IgG | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS3-2376HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
BPNT1-8415HCL | Recombinant Human BPNT1 293 Cell Lysate | +Inquiry |
ABI2-9127HCL | Recombinant Human ABI2 293 Cell Lysate | +Inquiry |
IL34-2783MCL | Recombinant Mouse IL34 cell lysate | +Inquiry |
GSTK1-5714HCL | Recombinant Human GSTK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRA1 Products
Required fields are marked with *
My Review for All PRA1 Products
Required fields are marked with *
0
Inquiry Basket