Recombinant Full Length Ustilago Maydis Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Tim50) Protein, His-Tagged
Cat.No. : | RFL28597UF |
Product Overview : | Recombinant Full Length Ustilago maydis Mitochondrial import inner membrane translocase subunit TIM50(TIM50) Protein (Q4PEW9) (40-493aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ustilago maydis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (40-493) |
Form : | Lyophilized powder |
AA Sequence : | ATPSSSSKPPPPSPSGSPASSKPAKAESTDDAQSQPQPQPPAEPELARKGSSLFDIDTSA TPLASQLIEAEEAASRSDAGKGSTRAKAKTGARSMSSIERRRQNTVRILTGFVLIGAGLS AYKLGRPWESSAEAERFADSADAQTFVGRIKLRLNAMYDDYNKPLFEQLLPDPLPFPYSR PFTMVIDIDDLLVHSEWSREHGWRTAKRPGLDHFLGYLSQFYEIVLFTTQPFFTAGPIIE KLDPDRRFITYTLFRESCRTVDGKLVKDLNHLNRDLSKVVVVDTNPDSFHLHPENGILVK PWKGEREDRELIGLIPFFEAIGIYNIDDVRNTIKAYTGTHIPTEHARRTAAIRERELADN KARLERMGKFGSVFGRVSRSASAGLPADKTLYDLERERYLQAYLEEQKYWNENGDAIRKQ AKDEQDRQIREMKINTWGFFTGGLKPQQPETPAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TIM50 |
Synonyms | TIM50; UMAG_01344; Mitochondrial import inner membrane translocase subunit TIM50 |
UniProt ID | Q4PEW9 |
◆ Recombinant Proteins | ||
PISD-001H | Recombinant Human PISD Protein, His-tagged | +Inquiry |
ABP1-3862M | Recombinant Maize ABP1 protein, His-tagged | +Inquiry |
GRIK1-2748H | Recombinant Human GRIK1 protein(291-530 aa), C-His-tagged | +Inquiry |
Muc1-619M | Recombinant Mouse Muc1 Protein, His-tagged | +Inquiry |
RFL15682DF | Recombinant Full Length Danio Rerio Probable G Protein-Coupled Receptor 85(Gpr85) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-81H | Active Native Human FSH | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGFRN-856CCL | Recombinant Cynomolgus PTGFRN cell lysate | +Inquiry |
JUNB-886HCL | Recombinant Human JUNB cell lysate | +Inquiry |
RASGRP1-2506HCL | Recombinant Human RASGRP1 293 Cell Lysate | +Inquiry |
FOXA3-662HCL | Recombinant Human FOXA3 cell lysate | +Inquiry |
Small Intestine-448H | Human Small Intestine Liver Cirrhosis Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIM50 Products
Required fields are marked with *
My Review for All TIM50 Products
Required fields are marked with *
0
Inquiry Basket